PDB entry 5giv

View 5giv on RCSB PDB site
Description: Crystal structure of M32 carboxypeptidase from Deinococcus radiodurans R1
Class: hydrolase
Keywords: M32 carboxypeptidase, Cobalt, Metallopeptidase, HYDROLASE
Deposited on 2016-06-25, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase 1
    Species: Deinococcus radiodurans str. R1 [TaxId:243230]
    Gene: DR_2423
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5giva_
  • Chain 'B':
    Compound: carboxypeptidase 1
    Species: Deinococcus radiodurans str. R1 [TaxId:243230]
    Gene: DR_2423
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5givb_
  • Chain 'C':
    Compound: carboxypeptidase 1
    Species: Deinococcus radiodurans str. R1 [TaxId:243230]
    Gene: DR_2423
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5givc_
  • Chain 'D':
    Compound: carboxypeptidase 1
    Species: Deinococcus radiodurans str. R1 [TaxId:243230]
    Gene: DR_2423
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5givd_
  • Chain 'E':
    Compound: carboxypeptidase 1
    Species: Deinococcus radiodurans str. R1 [TaxId:243230]
    Gene: DR_2423
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5give_
  • Chain 'F':
    Compound: carboxypeptidase 1
    Species: Deinococcus radiodurans str. R1 [TaxId:243230]
    Gene: DR_2423
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5givf_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5givA (A:)
    mtttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrhar
    atdagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawt
    earpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelr
    aalvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtr
    lgghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsr
    lwenlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlh
    vitrfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfq
    gytignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelierat
    gqaltagpylkylrgkygelygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5givA (A:)
    dtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharatdagy
    gklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtearpan
    dfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraalvpl
    adaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlgghdv
    rittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlwenlv
    grsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvitrfe
    leremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgytign
    vlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgqalta
    gpylkylrgkygelygv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5givB (B:)
    mtttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrhar
    atdagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawt
    earpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelr
    aalvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtr
    lgghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsr
    lwenlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlh
    vitrfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfq
    gytignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelierat
    gqaltagpylkylrgkygelygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5givB (B:)
    ttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharat
    dagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtea
    rpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraa
    lvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlg
    ghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlw
    enlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvi
    trfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgy
    tignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgq
    altagpylkylrgkygelygv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5givC (C:)
    mtttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrhar
    atdagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawt
    earpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelr
    aalvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtr
    lgghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsr
    lwenlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlh
    vitrfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfq
    gytignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelierat
    gqaltagpylkylrgkygelygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5givC (C:)
    qwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharatdagygk
    lldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtearpandf
    grmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraalvplad
    aviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlgghdvri
    ttrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlwenlvgr
    srafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvitrfele
    remlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgytignvl
    saqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgqaltagp
    ylkylrgkygelygv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5givD (D:)
    mtttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrhar
    atdagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawt
    earpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelr
    aalvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtr
    lgghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsr
    lwenlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlh
    vitrfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfq
    gytignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelierat
    gqaltagpylkylrgkygelygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5givD (D:)
    dtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharatdagy
    gklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtearpan
    dfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraalvpl
    adaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlgghdv
    rittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlwenlv
    grsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvitrfe
    leremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgytign
    vlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgqalta
    gpylkylrgkygelygv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5givE (E:)
    mtttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrhar
    atdagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawt
    earpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelr
    aalvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtr
    lgghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsr
    lwenlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlh
    vitrfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfq
    gytignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelierat
    gqaltagpylkylrgkygelygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5givE (E:)
    dtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharatdagy
    gklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtearpan
    dfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraalvpl
    adaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlgghdv
    rittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlwenlv
    grsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvitrfe
    leremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgytign
    vlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgqalta
    gpylkylrgkygelygv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5givF (F:)
    mtttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrhar
    atdagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawt
    earpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelr
    aalvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtr
    lgghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsr
    lwenlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlh
    vitrfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfq
    gytignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelierat
    gqaltagpylkylrgkygelygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5givF (F:)
    ttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharat
    dagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtea
    rpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraa
    lvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlg
    ghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlw
    enlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvi
    trfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgy
    tignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgq
    altagpylkylrgkygelygv