PDB entry 5git

View 5git on RCSB PDB site
Description: BTB domain of KEAP1 in complex with XX3
Class: transcription
Keywords: signaling protein, transcription
Deposited on 2016-06-25, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Keap1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14145 (Start-136)
      • conflict (128)
    Domains in SCOPe 2.07: d5gita_
  • Heterogens: XXT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gitA (A:)
    gshmgnrtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlass
    spvfkamftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyq
    idsvvracadflvqqld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gitA (A:)
    tfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfkam
    ftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvra
    cadflvqqld