PDB entry 5ghl

View 5ghl on RCSB PDB site
Description: Crystal structure Analysis of the starch-binding domain of glucoamylase from Aspergillus niger
Class: hydrolase
Keywords: beta-sheet structure, HYDROLASE
Deposited on 2016-06-20, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucoamylase
    Species: Aspergillus niger [TaxId:5061]
    Gene: GLAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ghla_
  • Chain 'B':
    Compound: glucoamylase
    Species: Aspergillus niger [TaxId:5061]
    Gene: GLAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ghlb_
  • Chain 'C':
    Compound: glucoamylase
    Species: Aspergillus niger [TaxId:5061]
    Gene: GLAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ghlc_
  • Chain 'D':
    Compound: glucoamylase
    Species: Aspergillus niger [TaxId:5061]
    Gene: GLAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ghld_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ghlA (A:)
    cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
    lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ghlB (B:)
    cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
    lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ghlC (C:)
    cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
    lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ghlD (D:)
    cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
    lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr