PDB entry 5ghi

View 5ghi on RCSB PDB site
Description: Crystal structure of human MTH1(G2K mutant) in complex with 8-oxo-dGTP
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, hydrolase, DNA damage, DNA repair, DNA replication
Deposited on 2016-06-20, released 2017-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (0-155)
      • engineered mutation (1)
    Domains in SCOPe 2.08: d5ghia_
  • Chain 'B':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (0-155)
      • engineered mutation (1)
    Domains in SCOPe 2.08: d5ghib_
  • Heterogens: 8DG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ghiA (A:)
    mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
    vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
    sywfplllqkkkfhgyfkfqgqdtildytlrevdtv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ghiB (B:)
    mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
    vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdd
    sywfplllqkkkfhgyfkfqgqdtildytlrevdtv