PDB entry 5ggy

View 5ggy on RCSB PDB site
Description: X-ray crystal structure of Periplasmic Desferal binding protein FhuD from Vibrio cholerae
Class: transport protein
Keywords: Vibrio cholerae, Ferric siderophore binding protein, ABC transporter, Periplasmic, Desferal, apo-FhuD, TRANSPORT PROTEIN
Deposited on 2016-06-16, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron(III) ABC transporter, periplasmic iron-compound-binding protein
    Species: Vibrio cholerae [TaxId:345073]
    Gene: VC0395_A2582
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H3AJ03 (17-281)
      • expression tag (15-16)
    Domains in SCOPe 2.07: d5ggya1, d5ggya2
  • Chain 'N':
    Compound: Iron(III) ABC transporter, periplasmic iron-compound-binding protein
    Species: Vibrio cholerae [TaxId:345073]
    Gene: VC0395_A2582
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H3AJ03 (17-End)
      • expression tag (15-16)
    Domains in SCOPe 2.07: d5ggyn1, d5ggyn2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ggyA (A:)
    hhhhhhssglvprgshmrvvvlnwdlleqvlelgiqpvgapelssyvqwvvqpevpssvq
    digtrtepnlekiaalkpdvilaagpqqdllatlgriapvvylpnfseqdnaaqvaishf
    ktlatlfgkeavaqqkleamyarfselkaslqhafgdtlpavvtlrfanptsvflytens
    tpqyvleqlglssalpqppkewgivqkrlselqhveqgyvlyflpfaeekkvqksvlwra
    mpfvqagrvnsvrpvwsyggamslrysaeaitesllavapqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ggyA (A:)
    hmrvvvlnwdlleqvlelgiqpvgapelssyvqwvvqpevpssvqdigtrtepnlekiaa
    lkpdvilaagpqqdllatlgriapvvylpnfseqdnaaqvaishfktlatlfgkeavaqq
    kleamyarfselkaslqhafgdtlpavvtlrfanptsvflytenstpqyvleqlglssal
    pqppkewgivqkrlselqhveqgyvlyflpfaeekkvqksvlwrampfvqagrvnsvrpv
    wsyggamslrysaeaitesllavapqs
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5ggyN (N:)
    hhhhhhssglvprgshmrvvvlnwdlleqvlelgiqpvgapelssyvqwvvqpevpssvq
    digtrtepnlekiaalkpdvilaagpqqdllatlgriapvvylpnfseqdnaaqvaishf
    ktlatlfgkeavaqqkleamyarfselkaslqhafgdtlpavvtlrfanptsvflytens
    tpqyvleqlglssalpqppkewgivqkrlselqhveqgyvlyflpfaeekkvqksvlwra
    mpfvqagrvnsvrpvwsyggamslrysaeaitesllavapqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ggyN (N:)
    hmrvvvlnwdlleqvlelgiqpvgapelssyvqwvvqpevpssvqdigtrtepnlekiaa
    lkpdvilaagpqqdllatlgriapvvylpnfseqdnaaqvaishfktlatlfgkeavaqq
    kleamyarfselkaslqhafgdtlpavvtlrfanptsvflytenstpqyvleqlglssal
    pqppkewgivqkrlselqhveqgyvlyflpfaeekkvqksvlwrampfvqagrvnsvrpv
    wsyggamslrysaeaitesllavapq