PDB entry 5ggm

View 5ggm on RCSB PDB site
Description: The NMR structure of calmodulin in CTAB reverse micelles
Class: signaling protein
Keywords: compact, two-domain, SIGNALING PROTEIN
Deposited on 2016-06-16, released 2016-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: CALM, CAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (Start-147)
      • engineered mutation (59)
    Domains in SCOPe 2.06: d5ggma_
  • Heterogens: CA, TB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ggmA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgd
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ggmA (A:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgdgt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    emireadidgdgqvnyeefvqmmtak