PDB entry 5g5k

View 5g5k on RCSB PDB site
Description: Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin
Class: hydrolase
Keywords: hydrolase, cell-wall recycling, antibiotic resistance, glycoside hydrolase, n-acetylglucosaminidase, beta-hexosaminidase, inhibition, peptidoglycan
Deposited on 2016-05-25, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZK0 (20-351)
      • expression tag (19)
    Domains in SCOPe 2.06: d5g5ka1, d5g5ka2
  • Chain 'B':
    Compound: Beta-hexosaminidase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g5kb_
  • Heterogens: NOK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g5kA (A:)
    mgsshhhhhhssglvprgshmqgslmldiggtwltaedrqilrhpevggliifarniehp
    aqvrelcaairairpdlllavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwl
    matevqavgldlsfapvldldhqrsavvgsrafegdperaallagafirgmhaagmaatg
    khfpghgwaeadshvaipedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpa
    gfsrrwlqeilrgelkfdgvifsddlsmagahvvgdaasrieaalaagcdmglvcndras
    aelalaalqrlkvtppsrlqrmrgkgyantdyrqqprwlealsalraaqlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5kA (A:)
    hmqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdlll
    avdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvld
    ldhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvaipe
    darsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdg
    vifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrl
    qrmrgkgyantdyrqqprwlealsalraaqlid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g5kB (B:)
    mgsshhhhhhssglvprgshmqgslmldiggtwltaedrqilrhpevggliifarniehp
    aqvrelcaairairpdlllavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwl
    matevqavgldlsfapvldldhqrsavvgsrafegdperaallagafirgmhaagmaatg
    khfpghgwaeadshvaipedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpa
    gfsrrwlqeilrgelkfdgvifsddlsmagahvvgdaasrieaalaagcdmglvcndras
    aelalaalqrlkvtppsrlqrmrgkgyantdyrqqprwlealsalraaqlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5kB (B:)
    mqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdllla
    vdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvldl
    dhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvaiped
    arsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdgv
    ifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrlq
    rmrgkgyantdyrqqprwlealsalraaqlid