PDB entry 5g5j

View 5g5j on RCSB PDB site
Description: Crystal structure of human CYP3A4 bound to metformin
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase
Deposited on 2016-05-25, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g5ja_
  • Heterogens: MF8, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g5jA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5jA (A:)
    hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
    dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
    iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
    kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesdflqlmid
    sqhkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnkap
    ptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalhrd
    pkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqnfs
    fkpcketqiplklslggllqpekpvvlkvesrd