PDB entry 5g5a

View 5g5a on RCSB PDB site
Description: Glutathione transferase U25 from Arabidopsis thaliana in complex with glutathione disulfide
Class: transferase
Keywords: transferase, glutathione, arabidopsis, tnt
Deposited on 2016-05-23, released 2017-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase u25
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g5aa1, d5g5aa2
  • Chain 'B':
    Compound: glutathione s-transferase u25
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g5ab1, d5g5ab2
  • Chain 'C':
    Compound: glutathione s-transferase u25
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g5ac1, d5g5ac2
  • Chain 'D':
    Compound: glutathione s-transferase u25
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g5ad1, d5g5ad2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g5aA (A:)
    madevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihn
    gnpvcesliqieyidevwpsktpllpsdpyqraqakfwgdfidkkvyasarliwgakgee
    heagkkefieilktleselgdktyfggetfgyvdialigfyswfeayekfgsfsieaecp
    kliawgkrcveresvakslpdsekiikfvpelrkklgieie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5aA (A:)
    adevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihng
    npvcesliqieyidevwpsktpllpsdpyqraqakfwgdfidkkvyasarliwgakgeeh
    eagkkefieilktleselgdktyfggetfgyvdialigfyswfeayekfgsfsieaecpk
    liawgkrcveresvakslpdsekiikfvpelrkklgiei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g5aB (B:)
    madevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihn
    gnpvcesliqieyidevwpsktpllpsdpyqraqakfwgdfidkkvyasarliwgakgee
    heagkkefieilktleselgdktyfggetfgyvdialigfyswfeayekfgsfsieaecp
    kliawgkrcveresvakslpdsekiikfvpelrkklgieie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5aB (B:)
    adevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihng
    npvcesliqieyidevwpsktpllpsdpyqraqakfwgdfidkkvyasarliwgakgeeh
    eagkkefieilktleselgdktyfggetfgyvdialigfyswfeayekfgsfsieaecpk
    liawgkrcveresvakslpdsekiikfvpelrkklgiei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5g5aC (C:)
    madevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihn
    gnpvcesliqieyidevwpsktpllpsdpyqraqakfwgdfidkkvyasarliwgakgee
    heagkkefieilktleselgdktyfggetfgyvdialigfyswfeayekfgsfsieaecp
    kliawgkrcveresvakslpdsekiikfvpelrkklgieie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5aC (C:)
    adevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihng
    npvcesliqieyidevwpsktpllpsdpyqraqakfwgdfidkkvyasarliwgakgeeh
    eagkkefieilktleselgdktyfggetfgyvdialigfyswfeayekfgsfsieaecpk
    liawgkrcveresvakslpdsekiikfvpelrkklgiei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5g5aD (D:)
    madevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihn
    gnpvcesliqieyidevwpsktpllpsdpyqraqakfwgdfidkkvyasarliwgakgee
    heagkkefieilktleselgdktyfggetfgyvdialigfyswfeayekfgsfsieaecp
    kliawgkrcveresvakslpdsekiikfvpelrkklgieie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5aD (D:)
    devilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihngn
    pvcesliqieyidevwpsktpllpsdpyqraqakfwgdfidkkvyasarliwgakgeehe
    agkkefieilktleselgdktyfggetfgyvdialigfyswfeayekfgsfsieaecpkl
    iawgkrcveresvakslpdsekiikfvpelrkklgiei