PDB entry 5g57

View 5g57 on RCSB PDB site
Description: Crystal structure of T. brucei PDE-B1 catalytic domain with inhibitor NPD-001
Class: hydrolase
Keywords: parasitic pde, african trypanosomiasis, sleeping sickness, hydrolase
Deposited on 2016-05-22, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphodiesterase b1
    Species: TRYPANOSOMA BRUCEI [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g57a_
  • Chain 'B':
    Compound: phosphodiesterase b1
    Species: TRYPANOSOMA BRUCEI [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g57b_
  • Heterogens: ZN, MG, FMT, GOL, PEG, GAI, 6M5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g57A (A:)
    gshmaselnehratlfnknvpsravkrvtaitkvereavlvcelpsfdvtdvefdlfrar
    estdkpldvaaaiayrlllgsglpqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvc
    qtihtflyrgnvyekltelecfvllitalvhdldhmglnnsfylktesplgilssasgnt
    svlevhhcnlaveilsdpesdvfdglegaertlafrsmidcvlatdmakhgsaleaflas
    aadqssdeaafhrmtmeiilkagdisnvtkpfdisrqwamavteefyrqgdmekergvev
    lpmfdrsknmelakgqigfidfvaapffqkivdaclqgmqwtvdriksnraqwervletr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g57A (A:)
    vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
    gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
    alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
    gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
    vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
    fqkivdaclqgmqwtvdriksnraqwervletr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g57B (B:)
    gshmaselnehratlfnknvpsravkrvtaitkvereavlvcelpsfdvtdvefdlfrar
    estdkpldvaaaiayrlllgsglpqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvc
    qtihtflyrgnvyekltelecfvllitalvhdldhmglnnsfylktesplgilssasgnt
    svlevhhcnlaveilsdpesdvfdglegaertlafrsmidcvlatdmakhgsaleaflas
    aadqssdeaafhrmtmeiilkagdisnvtkpfdisrqwamavteefyrqgdmekergvev
    lpmfdrsknmelakgqigfidfvaapffqkivdaclqgmqwtvdriksnraqwervletr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g57B (B:)
    vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
    gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
    alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
    gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
    vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
    fqkivdaclqgmqwtvdriksnraqwervlet