PDB entry 5g55

View 5g55 on RCSB PDB site
Description: 3-Quinoline Carboxamides inhibitors of Pi3K
Class: transferase
Keywords: transferase, atm
Deposited on 2016-05-20, released 2016-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • conflict (125)
    Domains in SCOPe 2.06: d5g55a1, d5g55a2, d5g55a3, d5g55a4
  • Heterogens: 3QH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g55A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqserdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g55A (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmrdfvlrvcgrd
    eylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeewdcdrkfrvkirgidi
    pvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgalln
    lqiycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisill
    dnychraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkw
    gqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlh
    yllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavile
    aylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsq
    lpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddl
    rqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgn
    tgafkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetg
    nlfhidfghilgnervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnll
    iilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwf
    lhlvlgi