PDB entry 5g4s

View 5g4s on RCSB PDB site
Description: BROMODOMAIN OF HUMAN BRPF1 WITH N-1,3-dimethyl-6-2R-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1H-1,3-benzodiazol-5-yl-N- ethyl-2-methoxybenzamide
Class: transcription
Keywords: transcription
Deposited on 2016-05-16, released 2016-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55201 (3-117)
      • expression tag (2)
    Domains in SCOPe 2.06: d5g4sa1, d5g4sa2
  • Heterogens: 8VI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5g4sA (A:)
gqeiamemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkq
nleayrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaek

    Sequence, based on observed residues (ATOM records): (download) 
    >5g4sA (A:)
eiamemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnl
eayrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaek