PDB entry 5g4p

View 5g4p on RCSB PDB site
Description: Crystal structure of human hippocalcin at 2.4 A resolution
Class: calcium binding protein
Keywords: calcium binding protein, ca binding protein, calcium-binding protein
Deposited on 2016-05-15, released 2017-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuron-specific calcium-binding protein hippocalcin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPCA, BDR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g4pa_
  • Chain 'E':
    Compound: Neuron-specific calcium-binding protein hippocalcin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPCA, BDR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g4pe_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g4pA (A:)
    mgkqnsklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygd
    askfaehvfrtfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisree
    mleivqaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsiv
    rllqcdpssasqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g4pA (A:)
    sklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygdaskfa
    ehvfrtfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisreemleiv
    qaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsivrllqc
    dpss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5g4pE (E:)
    mgkqnsklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygd
    askfaehvfrtfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisree
    mleivqaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsiv
    rllqcdpssasqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g4pE (E:)
    klrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygdaskfae
    hvfrtfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisreemleivq
    aiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsivrllqcd
    pssa