PDB entry 5g49

View 5g49 on RCSB PDB site
Description: Crystal structure of the Arabodopsis thaliana histone-fold dimer L1L NF-YC3
Class: transcription
Keywords: transcription, histone-fold domain, nf-y, transcription factor, ccaat box- binding transcription factor
Deposited on 2016-05-06, released 2016-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear transcription factor y subunit b-6
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84W66 (4-96)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d5g49a1, d5g49a2
  • Chain 'B':
    Compound: nuclear transcription factor y subunit c-3
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5g49b_
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g49A (A:)
    gshmtvreqdrfmpianvirimrrilpahakisddsketiqecvseyisfitgeanercq
    reqrktitaedvlwamsklgfddyiepltlylhryre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g49B (B:)
    mtqfkeiekttdfknhslplarikkimkadedvrmisaeapvvfaracemfileltlrsw
    nhteenkrrtlqkndiaaavtrtdifdflvdivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g49B (B:)
    tqfkeiekttdfknhslplarikkimkadedvrmisaeapvvfaracemfileltlrswn
    hteenkrrtlqkndiaaavtrtdifdflvdivpr