PDB entry 5g46

View 5g46 on RCSB PDB site
Description: Ligand complex of RORg LBD
Class: DNA binding protein
Keywords: DNA binding protein, rorg ligand, fragment screen, structure-based design, simultaneous binding
Deposited on 2016-05-04, released 2016-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (21-263)
      • expression tag (20)
      • expression tag (264-265)
    Domains in SCOPe 2.07: d5g46a1, d5g46a2, d5g46a3
  • Chain 'C':
    Compound: rorg
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G46 (0-9)
  • Heterogens: 6VD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g46A (A:)
    hnhnhnhnhnhnggenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsre
    evtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlv
    rmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytal
    vlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverl
    qifqhlhpivvqaafpplykelfsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g46A (A:)
    gaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfsgg
    

  • Chain 'C':
    No sequence available.