PDB entry 5g3r

View 5g3r on RCSB PDB site
Description: Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine and L-Ala-1,6-anhydroMurNAc
Class: hydrolase
Keywords: hydrolase, cell-wall recycling, antibiotic resistance, glycoside hydrolase, n-acetylglucosaminidase, beta-hexosaminidase, peptidoglycan
Deposited on 2016-04-30, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZK0 (20-351)
      • expression tag (17-19)
    Domains in SCOPe 2.06: d5g3ra1, d5g3ra2
  • Chain 'B':
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZK0 (20-351)
      • expression tag (19)
    Domains in SCOPe 2.06: d5g3rb1, d5g3rb2
  • Heterogens: NAG, 89A, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g3rA (A:)
    mgsshhhhhhssglvprgshmqgslmldiggtwltaedrqilrhpevggliifarniehp
    aqvrelcaairairpdlllavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwl
    matevqavgldlsfapvldldhqrsavvgsrafegdperaallagafirgmhaagmaatg
    khfpghgwaeadshvaipedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpa
    gfsrrwlqeilrgelkfdgvifsddlsmagahvvgdaasrieaalaagcdmglvcndras
    aelalaalqrlkvtppsrlqrmrgkgyantdyrqqprwlealsalraaqlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g3rA (A:)
    gshmqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdl
    llavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapv
    ldldhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvai
    pedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkf
    dgvifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtpps
    rlqrmrgkgyantdyrqqprwlealsalraaqlid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g3rB (B:)
    mgsshhhhhhssglvprgshmqgslmldiggtwltaedrqilrhpevggliifarniehp
    aqvrelcaairairpdlllavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwl
    matevqavgldlsfapvldldhqrsavvgsrafegdperaallagafirgmhaagmaatg
    khfpghgwaeadshvaipedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpa
    gfsrrwlqeilrgelkfdgvifsddlsmagahvvgdaasrieaalaagcdmglvcndras
    aelalaalqrlkvtppsrlqrmrgkgyantdyrqqprwlealsalraaqlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g3rB (B:)
    hmqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdlll
    avdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvld
    ldhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvaipe
    darsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdg
    vifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrl
    qrmrgkgyantdyrqqprwlealsalraaqlid