PDB entry 5g3l

View 5g3l on RCSB PDB site
Description: escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar
Class: toxin
Keywords: toxin, enterotoxin, ecoli, b subunit, sialic acid
Deposited on 2016-04-29, released 2016-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: Heat-labile enterotoxin IIB, B chain
  Species: ESCHERICHIA COLI [TaxId:634468]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.08: d5g3ld_
• Chain 'E':
  Compound: Heat-labile enterotoxin IIB, B chain
  Species: ESCHERICHIA COLI [TaxId:634468]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.08: d5g3le_
• Chain 'F':
  Compound: Heat-labile enterotoxin IIB, B chain
  Species: ESCHERICHIA COLI [TaxId:634468]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.08: d5g3lf_
• Chain 'G':
  Compound: Heat-labile enterotoxin IIB, B chain
  Species: ESCHERICHIA COLI [TaxId:634468]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.08: d5g3lg_
• Chain 'H':
  Compound: Heat-labile enterotoxin IIB, B chain
  Species: ESCHERICHIA COLI [TaxId:634468]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43529 (0-98)
  Domains in SCOPe 2.08: d5g3lh_
• Heterogens: NA, SIA, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5g3lD (D:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiaxaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5g3lE (E:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiaxaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5g3lF (F:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5g3lG (G:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiamaavlsgmrvnmcaspasspnviwaieleae
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5g3lH (H:)
  gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
  taemrkiaxaavlsgmrvnmcaspasspnviwaieleae