PDB entry 5g2z

View 5g2z on RCSB PDB site
Description: Crystallographic structure of mutant W31A of thioredoxin from Litopenaeus vannamei
Class: oxidoreductase
Keywords: oxidoreductase, thioredoxin, shrimp, litopenaeus vannamei, mutant, disulfide bond
Deposited on 2016-04-18, released 2017-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: LITOPENAEUS VANNAMEI [TaxId:6689]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B1PWB9 (0-104)
    • conflict (10)
    • engineered mutation (30)
  Domains in SCOPe 2.08: d5g2za_
• Chain 'B':
  Compound: thioredoxin
  Species: LITOPENAEUS VANNAMEI [TaxId:6689]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B1PWB9 (0-104)
    • conflict (10)
    • engineered mutation (30)
  Domains in SCOPe 2.08: d5g2zb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5g2zA (A:)
  mvyqvkdqedftkqlneagnklvvidfyatacgpckmiapkleelsqsmsdvvflkvdvd
  ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5g2zB (B:)
  mvyqvkdqedftkqlneagnklvvidfyatacgpckmiapkleelsqsmsdvvflkvdvd
  ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk