PDB entry 5g2n

View 5g2n on RCSB PDB site
Description: X-ray structure of PI3Kinase Gamma in complex with Copanlisib
Class: transferase
Keywords: transferase
Deposited on 2016-04-11, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g2na1, d5g2na2, d5g2na3, d5g2na4
  • Heterogens: 6E2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g2nA (A:)
    mllgsseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyam
    hpwvtskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkksl
    mdipesqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldev
    rkeewplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntd
    ltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgka
    palsskasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfn
    adkltsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleai
    iatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwd
    qsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsala
    rfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqv
    iemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalai
    ekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwete
    sldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspte
    ekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflgi
    nkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtg
    mpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqge
    khsaefglvprgsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g2nA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmdfvlrvcgrde
    ylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeewcdrkfrvkirgidipv
    ldltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycq
    llyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldnhpia
    aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
    aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
    qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
    gtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfr
    vpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmli
    lqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqtgafkdevlnhw
    lkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghier
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpdi
    eyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv