PDB entry 5g1m

View 5g1m on RCSB PDB site
Description: Crystal structure of NagZ from Pseudomonas aeruginosa
Class: hydrolase
Keywords: hydrolase, cell-wall recycling, peptidoglycan, antibiotic resistance, glycoside hydrolase, n-acetylglucosaminidase
Deposited on 2016-03-28, released 2017-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZK0 (20-351)
      • expression tag (19)
    Domains in SCOPe 2.06: d5g1ma1, d5g1ma2
  • Chain 'B':
    Compound: Beta-hexosaminidase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZK0 (20-351)
      • expression tag (19)
    Domains in SCOPe 2.06: d5g1mb1, d5g1mb2
  • Heterogens: CL, ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g1mA (A:)
    mgsshhhhhhssglvprgshmqgslmldiggtwltaedrqilrhpevggliifarniehp
    aqvrelcaairairpdlllavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwl
    matevqavgldlsfapvldldhqrsavvgsrafegdperaallagafirgmhaagmaatg
    khfpghgwaeadshvaipedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpa
    gfsrrwlqeilrgelkfdgvifsddlsmagahvvgdaasrieaalaagcdmglvcndras
    aelalaalqrlkvtppsrlqrmrgkgyantdyrqqprwlealsalraaqlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1mA (A:)
    hmqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdlll
    avdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvld
    ldhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvaipe
    darsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdg
    vifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrl
    qrmrgkgyantdyrqqprwlealsalraaqlid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g1mB (B:)
    mgsshhhhhhssglvprgshmqgslmldiggtwltaedrqilrhpevggliifarniehp
    aqvrelcaairairpdlllavdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwl
    matevqavgldlsfapvldldhqrsavvgsrafegdperaallagafirgmhaagmaatg
    khfpghgwaeadshvaipedarsleeirrsdlvpfarlagqldalmpahviypqvdpqpa
    gfsrrwlqeilrgelkfdgvifsddlsmagahvvgdaasrieaalaagcdmglvcndras
    aelalaalqrlkvtppsrlqrmrgkgyantdyrqqprwlealsalraaqlid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1mB (B:)
    hmqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdlll
    avdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvld
    ldhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadshvaipe
    darsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdg
    vifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrl
    qrmrgkgyantdyrqqprwlealsalraaqlid