PDB entry 5g0b

View 5g0b on RCSB PDB site
Description: An unusual natural product primary sulfonamide: synthesis, carbonic anhydrase inhibition and protein x-ray structure of Psammaplin C
Class: lyase
Keywords: lyase, protein engineering, natural product inhibitor, carbonic anhydrase
Deposited on 2016-03-17, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered mutation (64)
      • engineered mutation (66)
      • engineered mutation (68)
      • engineered mutation (90)
      • engineered mutation (129-130)
      • engineered mutation (133)
      • engineered mutation (168)
      • engineered mutation (202)
      • engineered mutation (204)
    Domains in SCOPe 2.07: d5g0ba_
  • Heterogens: ZN, SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g0bA (A:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nnghsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhl
    vhwntkygdvdkalqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdp
    rgllpesldywtypgslttpplaegvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g0bA (A:)
    hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
    hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
    ntkygdvdkalqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
    lpesldywtypgslttpplaegvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
    wrpaqplknrqikasfk