PDB entry 5g09

View 5g09 on RCSB PDB site
Description: The crystal structure of a S-selective transaminase from Bacillus megaterium bound with R-alpha-methylbenzylamine
Class: transferase
Keywords: transferase, transaminase
Deposited on 2016-03-17, released 2016-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaminase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G09
    Domains in SCOPe 2.06: d5g09a1, d5g09a2
  • Chain 'B':
    Compound: Transaminase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G09
    Domains in SCOPe 2.06: d5g09b_
  • Chain 'C':
    Compound: Transaminase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G09
    Domains in SCOPe 2.06: d5g09c1, d5g09c2
  • Chain 'D':
    Compound: Transaminase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G09
  • Heterogens: 6DF, PGE, 1PE, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g09A (A:)
    msltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqly
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqi
    pgssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsq
    gagsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakds
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptq
    iimkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g09A (A:)
    kinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlycvnlgq
    knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
    talniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqipgssyn
    savlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqgagsam
    ppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkglsssslp
    agavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsgeyirs
    klellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqiimkka
    lekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g09B (B:)
    msltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqly
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqi
    pgssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsq
    gagsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakds
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptq
    iimkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g09B (B:)
    ltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlycv
    nlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgs
    eavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqipg
    ssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqga
    gsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkglss
    sslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsge
    yirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqii
    mkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5g09C (C:)
    msltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqly
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqi
    pgssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsq
    gagsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakds
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptq
    iimkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g09C (C:)
    kinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlycvnlgq
    knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
    talniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqipgssyn
    savlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqgagsam
    ppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkglsssslp
    agavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsgeyirs
    klellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqiimkka
    lekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqa
    

  • Chain 'D':
    No sequence available.