PDB entry 5fzu

View 5fzu on RCSB PDB site
Description: crystal structure of n19d potato sti-kunitz bi-functional inhibitor of serine and aspartic proteases in space group p4322 and ph 7.2
Class: hydrolase inhibitor
Keywords: hydrolase, proteases, protease inhibitor, bi-functional protease inhibitor, hydrolase inhibitor, kunitz-type inhibitor
Deposited on 2016-03-15, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kti-a protein
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A097H118 (Start-186)
      • engineered mutation (18)
      • conflict (122)
    Domains in SCOPe 2.07: d5fzua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fzuA (A:)
    esplpkpvldtngkelnpdssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvg
    psgtpvrfiplstnifedqllniqfniptvklcvsytiwkvgnlnayfrtmlletggtig
    qadnsyfkivksskigynllscpftsiiclrcpedqfcakvgvviqngkrrlalvnenpl
    dvlfqev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fzuA (A:)
    plpkpvldtngkelnpdssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvgps
    gtpvrfiplstnifedqllniqfniptvklcvsytiwkvgnlnayfrtmlletggtigqa
    dnsyfkivksskigynllscpftsiiclrcpedqfcakvgvviqngkrrlalvnenpldv
    lfqev