PDB entry 5fxc

View 5fxc on RCSB PDB site
Description: Crystal structure of glycopeptide 22 in complex with scFv-SM3
Class: immune system
Keywords: immune system, glycopeptides, antibodies, molecular recognition, conformation analysis
Deposited on 2016-02-29, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: scfv-sm3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FXC (0-End)
    Domains in SCOPe 2.07: d5fxch1, d5fxch2, d5fxch3
  • Chain 'P':
    Compound: glycopeptide
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FXC (0-5)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5fxcH (H:)
    qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvssssg
    gggsgggggssgssdivvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlf
    tgliggtnnrapgvparfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkl
    tvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fxcH (H:)
    qvqlqesggglvqpggsmklscvasgftfsnywmnwvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctgvgqfaywgqgttvtvsivvt
    qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvparfs
    gsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl
    

  • Chain 'P':
    No sequence available.