PDB entry 5fwg

View 5fwg on RCSB PDB site
Description: tetra-(5-fluorotryptophanyl)-glutathione transferase
Deposited on 1997-11-08, released 1999-01-27
The last revision prior to the SCOP 1.61 freeze date was dated 1999-01-27, with a file datestamp of 1999-01-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fwgA (A:)
    pmilgyxnvrglthpirllleytdssyeekryamgdapdydrsqxlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpxfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqxsnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fwgB (B:)
    pmilgyxnvrglthpirllleytdssyeekryamgdapdydrsqxlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpxfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqxsnk