PDB entry 5fv4

View 5fv4 on RCSB PDB site
Description: Pig liver esterase 5 (PLE5)
Class: hydrolase
Keywords: hydrolase, esterase, esterase-lipase superfamily, carboxylesterase
Deposited on 2016-02-03, released 2017-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxylic ester hydrolase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9GYW6
      • conflict (72)
      • conflict (74-75)
      • conflict (79)
      • conflict (458)
      • conflict (460)
      • conflict (462)
    Domains in SCOPe 2.06: d5fv4a_
  • Chain 'B':
    Compound: Carboxylic ester hydrolase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9GYW6
      • conflict (72)
      • conflict (74-75)
      • conflict (79)
      • conflict (458)
      • conflict (460)
      • conflict (462)
    Domains in SCOPe 2.06: d5fv4b_
  • Chain 'C':
    Compound: Carboxylic ester hydrolase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9GYW6
      • conflict (72)
      • conflict (74-75)
      • conflict (79)
      • conflict (458)
      • conflict (460)
      • conflict (462)
    Domains in SCOPe 2.06: d5fv4c_
  • Chain 'D':
    Compound: Carboxylic ester hydrolase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9GYW6
      • conflict (72)
      • conflict (74-75)
      • conflict (79)
      • conflict (458)
      • conflict (460)
      • conflict (462)
    Domains in SCOPe 2.06: d5fv4d_
  • Chain 'E':
    Compound: Carboxylic ester hydrolase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9GYW6
      • conflict (72)
      • conflict (74-75)
      • conflict (79)
      • conflict (458)
      • conflict (460)
      • conflict (462)
    Domains in SCOPe 2.06: d5fv4e_
  • Chain 'F':
    Compound: Carboxylic ester hydrolase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9GYW6
      • conflict (72)
      • conflict (74-75)
      • conflict (79)
      • conflict (458)
      • conflict (460)
      • conflict (462)
    Domains in SCOPe 2.06: d5fv4f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fv4A (A:)
    gqpasppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfv
    knttsyppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmv
    wihggglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaa
    lhwvqenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvr
    kdmkaaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpf
    lttvvdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktat
    sllwksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrd
    agaptymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkf
    wanfarsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllskeaakkp
    pkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fv4A (A:)
    sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvkntt
    syppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmvwihg
    gglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaalhwv
    qenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvrkdmk
    aaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpflttv
    vdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllw
    ksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrdagap
    tymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfwanf
    arsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fv4B (B:)
    gqpasppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfv
    knttsyppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmv
    wihggglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaa
    lhwvqenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvr
    kdmkaaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpf
    lttvvdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktat
    sllwksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrd
    agaptymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkf
    wanfarsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllskeaakkp
    pkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fv4B (B:)
    sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvkntt
    syppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmvwihg
    gglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaalhwv
    qenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvrkdmk
    aaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpflttv
    vdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllw
    ksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrdagap
    tymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfwanf
    arsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fv4C (C:)
    gqpasppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfv
    knttsyppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmv
    wihggglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaa
    lhwvqenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvr
    kdmkaaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpf
    lttvvdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktat
    sllwksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrd
    agaptymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkf
    wanfarsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllskeaakkp
    pkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fv4C (C:)
    sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvkntt
    syppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmvwihg
    gglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaalhwv
    qenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvrkdmk
    aaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpflttv
    vdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllw
    ksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrdagap
    tymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfwanf
    arsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fv4D (D:)
    gqpasppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfv
    knttsyppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmv
    wihggglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaa
    lhwvqenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvr
    kdmkaaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpf
    lttvvdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktat
    sllwksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrd
    agaptymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkf
    wanfarsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllskeaakkp
    pkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fv4D (D:)
    sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvkntt
    syppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmvwihg
    gglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaalhwv
    qenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvrkdmk
    aaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpflttv
    vdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllw
    ksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrdagap
    tymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfwanf
    arsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5fv4E (E:)
    gqpasppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfv
    knttsyppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmv
    wihggglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaa
    lhwvqenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvr
    kdmkaaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpf
    lttvvdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktat
    sllwksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrd
    agaptymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkf
    wanfarsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllskeaakkp
    pkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fv4E (E:)
    sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvkntt
    syppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmvwihg
    gglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaalhwv
    qenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvrkdmk
    aaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpflttv
    vdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllw
    ksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrdagap
    tymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfwanf
    arsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5fv4F (F:)
    gqpasppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfv
    knttsyppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmv
    wihggglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaa
    lhwvqenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvr
    kdmkaaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpf
    lttvvdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktat
    sllwksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrd
    agaptymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkf
    wanfarsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllskeaakkp
    pkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fv4F (F:)
    sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvkntt
    syppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmvwihg
    gglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaalhwv
    qenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvrkdmk
    aaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpflttv
    vdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllw
    ksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrdagap
    tymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfwanf
    arsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk