PDB entry 5fuc

View 5fuc on RCSB PDB site
Description: Biophysical and cellular characterisation of a junctional epitope antibody that locks IL-6 and gp80 together in a stable complex: implications for new therapeutic strategies
Class: immune system
Keywords: vhh, il-6, il-6 receptor alpha, il-6 receptor beta, gp80, antibody, junctional epitope, immune system
Deposited on 2016-01-25, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05231 (2-165)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5fuca1, d5fuca2
  • Chain 'B':
    Compound: interleukin-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fucb_
  • Chain 'C':
    Compound: interleukin-6 receptor subunit alpha, interleukin-6 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6R9R8
      • engineered mutation (119)
      • engineered mutation (185)
    • Uniprot P08887
    Domains in SCOPe 2.07: d5fucc1, d5fucc2
  • Chain 'D':
    Compound: interleukin-6 receptor subunit alpha, interleukin-6 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6R9R8
      • engineered mutation (119)
      • engineered mutation (185)
    • Uniprot P08887
    Domains in SCOPe 2.07: d5fucd1, d5fucd2
  • Chain 'E':
    Compound: vhh6
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FUC
    Domains in SCOPe 2.07: d5fuce_
  • Chain 'V':
    Compound: vhh6
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FUC (0-End)
    Domains in SCOPe 2.07: d5fucv_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fucA (A:)
    gssseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
    neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
    pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fucA (A:)
    gssseridkqiryildgisalrketcnksnmcenlpkmaekdgcfqsgfneetclvkiit
    gllefevyleylqnrfesseeqaravqmstkvliqflqkkadaittpdpttnaslltklq
    aqnqwlqdmtthlilrsfkeflqsslralrqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fucB (B:)
    gssseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
    neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
    pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fucB (B:)
    sseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfne
    etclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkakittpdpttn
    aslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fucC (C:)
    glaprrcpaqevargagagdvppeepqlscfrksplsnvvcewgprstpslttkavllvr
    kfqnspaedfqepcqysqesqkfscqlavpegdssfyivsmcvassvgskfsktqtfqga
    gilqpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvk
    dlqhhavihdawsglrhvvqlraqeefgqgewsewspeamgtpwtesrspp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fucC (C:)
    pqlscfrksplsnvvcewgprstpslttkavllvrkfqnsaedfqepcqysqesqkfscq
    lavpegdssfyivsmcvassvgskfsktqtfqgagilqpdppanitvtavarnprwlsvt
    wqdphswnssfyrlrfelryraersktfttwmvkdlqhhavihdawsglrhvvqlraqee
    fgqgewsewspeamgtpwt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fucD (D:)
    glaprrcpaqevargagagdvppeepqlscfrksplsnvvcewgprstpslttkavllvr
    kfqnspaedfqepcqysqesqkfscqlavpegdssfyivsmcvassvgskfsktqtfqga
    gilqpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvk
    dlqhhavihdawsglrhvvqlraqeefgqgewsewspeamgtpwtesrspp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fucD (D:)
    ppeepqlscfrksplsnvvcewgprstpslttkavllvrkdfqepcqysqesqkfscqla
    vpegdssfyivsmcvassvgskfsktqtfqgagilqpdppanitvtavarnprwlsvtwq
    dphswnssfyrlrfelryraersktfttwmvkdlqhhavihdawsglrhvvqlraqeefg
    qgewsewspeamgtpwte
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5fucE (E:)
    dvqfvesgggsvhaggslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyy
    adsvkgrftisqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq
    vtvssrenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fucE (E:)
    qfvesgslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyyadsvkgrfti
    sqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5fucV (V:)
    dvqfvesgggsvhaggslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyy
    adsvkgrftisqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq
    vtvssrenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fucV (V:)
    dvqfvesgggsvhaggslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyy
    adsvkgrftisqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq
    vtvs