PDB entry 5ftz

View 5ftz on RCSB PDB site
Description: AA10 lytic polysaccharide monooxygenase (LPMO) from Streptomyces lividans
Class: lyase
Keywords: lyase, chitin, hyphal development
Deposited on 2016-01-19, released 2016-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitin binding protein
    Species: STREPTOMYCES LIVIDANS [TaxId:1200984]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ftza_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ftzA (A:)
hgytdlpvsrqkvcqngtvggcgaiqwepqsvegpkgfpasgpadgticsaghgsfaald
spkqpngqawpttrvnggqsytfrwqftarhattdfkyyvtkpgwnqnhnlarsdlnltp
fftvpyggkqppatlshsgtlpsglsghhvilavwtvhdtgnafyacsdvtf