PDB entry 5fta

View 5fta on RCSB PDB site
Description: Crystal structure of the N-terminal BTB domain of human KCTD10
Class: transferase
Keywords: transferase
Deposited on 2016-01-12, released 2016-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3F6
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5ftaa_
  • Chain 'B':
    Compound: btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3F6
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5ftab_
  • Chain 'C':
    Compound: btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3F6
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5ftac_
  • Chain 'D':
    Compound: btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3F6
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5ftad_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ftaA (A:)
    smgtspsskyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkh
    fgtilnylrdgavplpesrreieellaeakyylvqglveecqaalqnkdtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftaA (A:)
    sskyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkhfgtiln
    ylrdgavplpesrreieellaeakyylvqglveecqaalqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ftaB (B:)
    smgtspsskyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkh
    fgtilnylrdgavplpesrreieellaeakyylvqglveecqaalqnkdtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftaB (B:)
    sskyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkhfgtiln
    ylrdgavplpesrreieellaeakyylvqglveecqaalqn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ftaC (C:)
    smgtspsskyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkh
    fgtilnylrdgavplpesrreieellaeakyylvqglveecqaalqnkdtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftaC (C:)
    kyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkhfgtilnyl
    rdgavplpesrreieellaeakyylvqglveecqaal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ftaD (D:)
    smgtspsskyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkh
    fgtilnylrdgavplpesrreieellaeakyylvqglveecqaalqnkdtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftaD (D:)
    kyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkhfgtilnyl
    rdgavplpesrreieellaeakyylvqglveecqaalqn