PDB entry 5ft8

View 5ft8 on RCSB PDB site
Description: Structure of a Cysteine Desulfurase-Sulfur Acceptor Complex from Escherichia coli at 2.50 Angstroem resolution
Class: transferase
Keywords: transferase, l-cysteine desulfurase, sulfur acceptor, transpersulfuration, sulfur trafficking
Deposited on 2016-01-11, released 2016-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cysteine desulfurase csda
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8a_
  • Chain 'B':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGF2 (Start-146)
      • expression tag (147-150)
    Domains in SCOPe 2.06: d5ft8b1, d5ft8b2
  • Chain 'C':
    Compound: cysteine desulfurase csda
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8c_
  • Chain 'D':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGF2 (Start-146)
      • expression tag (147-150)
    Domains in SCOPe 2.06: d5ft8d1, d5ft8d2
  • Chain 'E':
    Compound: cysteine desulfurase csda
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8e_
  • Chain 'F':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8f_
  • Chain 'G':
    Compound: cysteine desulfurase csda
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8g_
  • Chain 'H':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGF2 (Start-146)
      • expression tag (147-149)
    Domains in SCOPe 2.06: d5ft8h1, d5ft8h2
  • Chain 'I':
    Compound: cysteine desulfurase csda
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8i_
  • Chain 'J':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8j_
  • Chain 'K':
    Compound: cysteine desulfurase csda
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8k_
  • Chain 'L':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8l_
  • Chain 'M':
    Compound: cysteine desulfurase csda
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8m_
  • Chain 'N':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8n_
  • Chain 'O':
    Compound: cysteine desulfurase csda
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ft8o_
  • Chain 'P':
    Compound: sulfur acceptor protein csde
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLP, CSS, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ft8A (A:)
    gamnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaea
    qrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvae
    hhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpd
    laraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksel
    leamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqae
    swsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhc
    aqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8A (A:)
    mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
    ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
    anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
    raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
    amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
    srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqp
    llaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ft8B (B:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8B (B:)
    pqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenr
    vwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraq
    lsasrsqglnalseaiiaatkqvkhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ft8C (C:)
    gamnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaea
    qrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvae
    hhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpd
    laraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksel
    leamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqae
    swsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhc
    aqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8C (C:)
    mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
    ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
    anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
    raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
    amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
    srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqp
    llaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ft8D (D:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8D (D:)
    ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvwlg
    ytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsas
    rsqglnalseaiiaatkqvkhhh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ft8E (E:)
    gamnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaea
    qrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvae
    hhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpd
    laraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksel
    leamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqae
    swsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhc
    aqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8E (E:)
    mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
    ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
    anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
    raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
    amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
    srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqp
    llaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ft8F (F:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8F (F:)
    hpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvwlgy
    tvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsasr
    sqglnalseaiiaat
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ft8G (G:)
    gamnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaea
    qrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvae
    hhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpd
    laraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksel
    leamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqae
    swsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhc
    aqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8G (G:)
    mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
    ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
    anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
    raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
    amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
    srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqp
    llaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ft8H (H:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8H (H:)
    faghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvw
    lgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqls
    asrsqglnalseaiiaatkqvkhh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5ft8I (I:)
    gamnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaea
    qrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvae
    hhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpd
    laraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksel
    leamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqae
    swsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhc
    aqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8I (I:)
    mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
    ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
    anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
    raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
    amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
    srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqp
    llaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5ft8J (J:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8J (J:)
    faghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvw
    lgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqls
    asrsqglnalseaiiaatkqv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5ft8K (K:)
    gamnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaea
    qrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvae
    hhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpd
    laraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksel
    leamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqae
    swsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhc
    aqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8K (K:)
    mnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqr
    ltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehh
    anlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdla
    raitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselle
    amspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesw
    srslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqp
    llaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ft8L (L:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8L (L:)
    ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvwlg
    ytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsas
    rsqglnalseaiiaatkqv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5ft8M (M:)
    gamnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaea
    qrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvae
    hhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpd
    laraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksel
    leamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqae
    swsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhc
    aqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8M (M:)
    vfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrlt
    aryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehhan
    lvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlara
    itfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselleam
    spwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaeswsr
    slatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqpll
    aelgvtgtlrasfapyntksdvdalvnavdralellvd
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5ft8N (N:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8N (N:)
    ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvwlg
    ytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsas
    rsqglnalseaiiaatkqv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5ft8O (O:)
    gamnvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaea
    qrltaryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvae
    hhanlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpd
    laraitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksel
    leamspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqae
    swsrslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhc
    aqpllaelgvtgtlrasfapyntksdvdalvnavdralellvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ft8O (O:)
    vfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrlt
    aryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehhan
    lvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlara
    itfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselleam
    spwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaeswsr
    slatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhaqpll
    aelgvtgtlrasfapyntksdvdalvnavdralellvd
    

  • Chain 'P':
    No sequence available.