PDB entry 5fpr

View 5fpr on RCSB PDB site
Description: Structure of Bacterial DNA Ligase with small-molecule ligand pyrimidin-2-amine (AT371) in an alternate binding site.
Class: ligase
Keywords: ligase, antibiotic design, protein-ligand complex, fragment screening, alternate binding site, at371.
Deposited on 2015-12-02, released 2015-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fpra_
  • Heterogens: SO4, LGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fprA (A:)
    madlssrvnelhdllnqysyeyyvednpsvpdseydkllhelikieeehpeyktvdsptv
    rvggeaqasfnkvnhdtpmlslgnafneddlrkfdqrireqignveymcelkidglavsl
    kyvdgyfvqgltrgdgttgeditenlktihaiplkmkeplnvevrgeaymprrsflrlne
    ekekndeqlfanprnaaagslrqldskltakrklsvfiysvndftdfnarsqsealdeld
    klgfttnknrarvnnidgvleyiekwtsqreslpydidgivikvndldqqdemgftqksp
    rwaiaykfpaeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fprA (A:)
    dlssrvnelhdllnqysyeyyvednpsvpdseydkllhelikieeehpeyktvdsptvrv
    ggeaqasfnkvnhdtpmlslgnafneddlrkfdqrireqignveymcelkidglavslky
    vdgyfvqgltrgdgttgeditenlktihaiplkmkeplnvevrgeaymprrsflrlneek
    ekndeqlfanprnaaagslrqldskltakrklsvfiysvndftdfnarsqsealdeldkl
    gfttnknrarvnnidgvleyiekwtsqreslpydidgivikvndldqqdemgftqksprw
    aiaykfp