PDB entry 5foq

View 5foq on RCSB PDB site
Description: Acetylcholinesterase in complex with C7653
Class: hydrolase
Keywords: hydrolase, signaling protein, quantum chemistry, density functional theory, drug design
Deposited on 2015-11-25, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FOQ (0-End)
    Domains in SCOPe 2.07: d5foqa_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FOQ
    Domains in SCOPe 2.07: d5foqb_
  • Heterogens: NAG, GC8, PG0, P15, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5foqA (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    satateap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5foqA (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdf
    lsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigv
    pqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvya
    yifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartg
    dpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5foqB (B:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    satateap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5foqB (B:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdflsd
    tpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpqa
    sdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayif
    ehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdpn
    dprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsata