PDB entry 5flf

View 5flf on RCSB PDB site
Description: disease linked mutation in fgfr
Class: transferase
Keywords: transferase, auto-activating, cancer, growth factor, receptor, mutation;
Deposited on 2015-10-26, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (32)
      • conflict (128)
      • engineered mutation (219)
    Domains in SCOPe 2.07: d5flfa_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (32)
      • engineered mutation (219)
    Domains in SCOPe 2.07: d5flfb_
  • Chain 'C':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (32)
      • engineered mutation (219)
    Domains in SCOPe 2.07: d5flfc_
  • Chain 'D':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (32)
      • engineered mutation (219)
    Domains in SCOPe 2.07: d5flfd_
  • Chain 'E':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (219)
    Domains in SCOPe 2.07: d5flfe_
  • Heterogens: SO4, ACT, CL, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5flfA (A:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdgiythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5flfA (A:)
    vseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksd
    atekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpp
    gleyseeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglar
    dihhidyykkttngrlpvkwmapealfdgiythqsdvwsfgvllweiftlggspypgvpv
    eelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5flfB (B:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdgiythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5flfB (B:)
    vseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksd
    atekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpp
    eqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhid
    yykkttngrlpvkwmapealfdgiythqsdvwsfgvllweiftlggspypgvpveelfkl
    lkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5flfC (C:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdgiythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5flfC (C:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekdlsd
    lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpeeqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkttng
    rlpvkwmapealfdgiythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmd
    kpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5flfD (D:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdgiythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5flfD (D:)
    lpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgleee
    qlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidy
    ykkttngrlpvkwmapealfdgiythqsdvwsfgvllweiftlggspypgvpveelfkll
    keghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5flfE (E:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdgiythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5flfE (E:)
    pedprwelprdrlvlgkplgqvvlaeaigldkdkpnrvtkvavkmlkatekdlsdlisem
    emmkmigkhkniinllgactqdgplyviveyaskgnlreylqarreqlsskdlvscayqv
    argmeylaskkcihrdlaarnvlvtednvmkiadfglagrlpvkwmapealfdgiythqs
    dvwsfgvllweiftlggspypgvpelfkllkeghrmdkpsnctnelymmmrdcwhavpsq
    rptfkqlvedldrivalt