PDB entry 5fk9

View 5fk9 on RCSB PDB site
Description: Crystal structure of staphylococcal enterotoxin A F47A mutant in complex with a T cell receptor
Class: immune system
Keywords: immune system, superantigen, staphylcococcal enterotoxin, t cell receptor, major histocompatibility complex
Deposited on 2015-10-15, released 2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FK9 (0-End)
    Domains in SCOPe 2.08: d5fk9a1, d5fk9a2
  • Chain 'B':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FK9
    Domains in SCOPe 2.08: d5fk9b1, d5fk9b2
  • Chain 'C':
    Compound: enterotoxin type a
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fk9c1, d5fk9c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fk9A (A:)
    mgiqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrl
    sattvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlaniqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fk9A (A:)
    mgiqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrl
    sattvaterysllyisssqttdsgvyfcavdsgtykyifgtgtrlkvlaniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrdfksnsavawsnksdfac
    anafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fk9B (B:)
    mdtgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksr
    llsdrfsaerpkgsfstleiqrteqgdsamylcasslggyeqyfgpgtrltvtedlknvf
    ppevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fk9B (B:)
    dtgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrl
    lsdrfsaerpkgsfstleiqrteqgdsamylcasslggyeqyfgpgtrltvtedlknvfp
    pevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fk9C (C:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqalqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fk9C (C:)
    lrkkselqgtalgnlkqiyyynekaktenkeshdhtilfkgfftdhswyndllvdfdskd
    ivdkykgkkvdlygayygyqcagpnktacmyggvtlhdnnrlteekkvpinlwldgkqnt
    vpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfhtstepsvnyd
    lfgaqgqysntllriyrdnktinsenmhidiylyts