PDB entry 5fju

View 5fju on RCSB PDB site
Description: N-acyl amino acid racemase from Amycolatopsis sp. Ts-1-60: Q26A M50I G291D F323Y mutant in complex with N-acetyl phenylalanine
Class: isomerase
Keywords: isomerase, racemase, n-acyl amino acid
Deposited on 2015-10-13, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-succinylbenzoate synthase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-367)
      • engineered mutation (25)
      • engineered mutation (49)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d5fjua1, d5fjua2
  • Chain 'B':
    Compound: o-succinylbenzoate synthase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (25)
      • engineered mutation (49)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d5fjub1, d5fjub2
  • Chain 'C':
    Compound: o-succinylbenzoate synthase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (25)
      • engineered mutation (49)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d5fjuc1, d5fjuc2
  • Chain 'D':
    Compound: o-succinylbenzoate synthase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (25)
      • engineered mutation (49)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d5fjud1, d5fjud2
  • Heterogens: MG, 5CR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fjuA (A:)
    mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fjuB (B:)
    mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fjuB (B:)
    mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fjuC (C:)
    mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fjuC (C:)
    mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fjuD (D:)
    mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fjuD (D:)
    mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig