PDB entry 5fjq

View 5fjq on RCSB PDB site
Description: Structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus
Class: sugar binding protein
Keywords: sugar binding protein
Deposited on 2015-10-12, released 2016-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbohydrate binding protein, putative, cpb33a
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5fjqa_
  • Chain 'B':
    Compound: carbohydrate binding protein, putative, cpb33a
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5fjqb_
  • Chain 'C':
    Compound: carbohydrate binding protein, putative, cpb33a
    Species: CELLVIBRIO JAPONICUS [TaxId:155077]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5fjqc_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fjqA (A:)
    hgyvsspksrviqckengienpthpaciaakaagngglytpqevavggvrdnhdyyipdg
    rlcsanranlfgmdlarndwpatsvtpgarefvwtntaahktkyfryyitpqgydhsqpl
    rwsdlqlihdsgpadqewvsthnvilpyrtgrhiiysiwqrdwdrdaaegfyqcidvdfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fjqB (B:)
    hgyvsspksrviqckengienpthpaciaakaagngglytpqevavggvrdnhdyyipdg
    rlcsanranlfgmdlarndwpatsvtpgarefvwtntaahktkyfryyitpqgydhsqpl
    rwsdlqlihdsgpadqewvsthnvilpyrtgrhiiysiwqrdwdrdaaegfyqcidvdfg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fjqC (C:)
    hgyvsspksrviqckengienpthpaciaakaagngglytpqevavggvrdnhdyyipdg
    rlcsanranlfgmdlarndwpatsvtpgarefvwtntaahktkyfryyitpqgydhsqpl
    rwsdlqlihdsgpadqewvsthnvilpyrtgrhiiysiwqrdwdrdaaegfyqcidvdfg