PDB entry 5fjp

View 5fjp on RCSB PDB site
Description: N-acyl amino acid racemase from Amycolatopsis sp Ts-1-60: G291D F323Y I293G mutant in complex with N-acetyl naphthylalanine
Class: lyase
Keywords: lyase, racemase, n-acylamino acid, naphthylalanine, isomerase
Deposited on 2015-10-12, released 2016-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-succinylbenzoate synthase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-367)
      • engineered mutation (290)
      • engineered mutation (292)
      • engineered mutation (322)
    Domains in SCOPe 2.06: d5fjpa1, d5fjpa2
  • Chain 'B':
    Compound: o-succinylbenzoate synthase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-367)
      • engineered mutation (290)
      • engineered mutation (292)
      • engineered mutation (322)
    Domains in SCOPe 2.06: d5fjpb1, d5fjpb2
  • Chain 'C':
    Compound: o-succinylbenzoate synthase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (290)
      • engineered mutation (292)
      • engineered mutation (322)
    Domains in SCOPe 2.06: d5fjpc1, d5fjpc2
  • Chain 'D':
    Compound: o-succinylbenzoate synthase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (290)
      • engineered mutation (292)
      • engineered mutation (322)
    Domains in SCOPe 2.06: d5fjpd1, d5fjpd2
  • Heterogens: NPQ, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fjpA (A:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmgetglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fjpB (B:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmgetglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fjpC (C:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmgetglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fjpC (C:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmgetglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fjpD (D:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmgetglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fjpD (D:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmgetglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig