PDB entry 5fjo

View 5fjo on RCSB PDB site
Description: N-acyl amino acid racemase from Amycolatopsis sp. Ts-1-60: G291D- F323Y mutant in complex with N-acetyl naphthylalanine
Class: lyase
Keywords: lyase, racemase, acyl amino acid, isomerase, amycolatopsis
Deposited on 2015-10-12, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d5fjoa1, d5fjoa2
  • Chain 'B':
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-367)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d5fjob1, d5fjob2
  • Heterogens: NPQ, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fjoA (A:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fjoA (A:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fjoB (B:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs