PDB entry 5fhz

View 5fhz on RCSB PDB site
Description: Human aldehyde dehydrogenase 1A3 complexed with NAD(+) and retinoic acid
Class: oxidoreductase
Keywords: Human, retinaldehyde dehydrogenase, tetramer, product-bound structure, oxidoreductase
Deposited on 2015-12-22, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde dehydrogenase family 1 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A3, ALDH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fhza_
  • Chain 'B':
    Compound: Aldehyde dehydrogenase family 1 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A3, ALDH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fhzb_
  • Chain 'C':
    Compound: Aldehyde dehydrogenase family 1 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A3, ALDH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fhzc_
  • Chain 'D':
    Compound: Aldehyde dehydrogenase family 1 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A3, ALDH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fhzd_
  • Chain 'E':
    Compound: Aldehyde dehydrogenase family 1 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A3, ALDH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fhze_
  • Chain 'F':
    Compound: Aldehyde dehydrogenase family 1 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A3, ALDH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fhzf_
  • Chain 'G':
    Compound: Aldehyde dehydrogenase family 1 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A3, ALDH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fhzg_
  • Chain 'H':
    Compound: Aldehyde dehydrogenase family 1 member A3
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH1A3, ALDH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fhzh_
  • Heterogens: NAD, REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fhzA (A:)
    hhhhhhlestslykkagmatangavengqpdrkppalprpirnlevkftkifinnewhes
    ksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspwrrldalsrgrllhql
    adlverdratlaaletmdtgkpflhaffidlegcirtlryfagwadkiqgktiptddnvv
    cftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeqtpltalylgslikea
    gfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkeaasrsnlkrvtlelgg
    knpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvysefvrrsveyakkrpv
    gdpfdvkteqgpqidqkqfdkileliesgkkegaklecggsamedkglfikptvfsevtd
    nmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtv
    wincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklgdknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhzA (A:)
    alprpirnlevkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaa
    qvafqrgspwrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegci
    rtlryfagwadkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccg
    ntmvlkpaeqtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgs
    tevgklvkeaasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaas
    rvfveeqvysefvrrsveyakkrpvgdpfdvkteqgpqidqkqfdkileliesgkkegak
    lecggsamedkglfikptvfsevtdnmriakeeifgpvqpilkfksieevikranstdyg
    ltaavftknldkalklasalesgtvwincynalyaqapfggfkmsgngrelgeyalaeyt
    evktvtikl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fhzB (B:)
    hhhhhhlestslykkagmatangavengqpdrkppalprpirnlevkftkifinnewhes
    ksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspwrrldalsrgrllhql
    adlverdratlaaletmdtgkpflhaffidlegcirtlryfagwadkiqgktiptddnvv
    cftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeqtpltalylgslikea
    gfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkeaasrsnlkrvtlelgg
    knpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvysefvrrsveyakkrpv
    gdpfdvkteqgpqidqkqfdkileliesgkkegaklecggsamedkglfikptvfsevtd
    nmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtv
    wincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklgdknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhzB (B:)
    rpirnlevkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaqva
    fqrgspwrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcirtl
    ryfagwadkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgntm
    vlkpaeqtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgstev
    gklvkeaasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasrvf
    veeqvysefvrrsveyakkrpvfdvkteqgpqieliesgkkegaklecggsamedkglfi
    kptvfsevtdnmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalk
    lasalesgtvwincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fhzC (C:)
    hhhhhhlestslykkagmatangavengqpdrkppalprpirnlevkftkifinnewhes
    ksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspwrrldalsrgrllhql
    adlverdratlaaletmdtgkpflhaffidlegcirtlryfagwadkiqgktiptddnvv
    cftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeqtpltalylgslikea
    gfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkeaasrsnlkrvtlelgg
    knpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvysefvrrsveyakkrpv
    gdpfdvkteqgpqidqkqfdkileliesgkkegaklecggsamedkglfikptvfsevtd
    nmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtv
    wincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklgdknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhzC (C:)
    lprpirnlevkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaq
    vafqrgspwrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcir
    tlryfagwadkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgn
    tmvlkpaeqtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgst
    evgklvkeaasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasr
    vfveeqvysefvrrsveyakkrpvgdpfdvkteqgpqidqkqfdkileliesgkkegakl
    ecggsamedkglfikptvfsevtdnmriakeeifgpvqpilkfksieevikranstdygl
    taavftknldkalklasalesgtvwincynalyaqapfggfkmsgngrelgeyalaeyte
    vktvtiklg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fhzD (D:)
    hhhhhhlestslykkagmatangavengqpdrkppalprpirnlevkftkifinnewhes
    ksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspwrrldalsrgrllhql
    adlverdratlaaletmdtgkpflhaffidlegcirtlryfagwadkiqgktiptddnvv
    cftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeqtpltalylgslikea
    gfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkeaasrsnlkrvtlelgg
    knpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvysefvrrsveyakkrpv
    gdpfdvkteqgpqidqkqfdkileliesgkkegaklecggsamedkglfikptvfsevtd
    nmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtv
    wincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklgdknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhzD (D:)
    lprpirnlevkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaq
    vafqrgspwrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcir
    tlryfagwadkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgn
    tmvlkpaeqtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgst
    evgklvkeaasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasr
    vfveeqvysefvrrsveyakkrpvgdpfdvkteqgpqidqkqfdkileliesgkkegakl
    ecggsamedkglfikptvfsevtdnmriakeeifgpvqpilkfksieevikranstdygl
    taavftknldkalklasalesgtvwincynalyaqapfggfkmsgngrelgeyalaeyte
    vktvtikl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5fhzE (E:)
    hhhhhhlestslykkagmatangavengqpdrkppalprpirnlevkftkifinnewhes
    ksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspwrrldalsrgrllhql
    adlverdratlaaletmdtgkpflhaffidlegcirtlryfagwadkiqgktiptddnvv
    cftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeqtpltalylgslikea
    gfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkeaasrsnlkrvtlelgg
    knpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvysefvrrsveyakkrpv
    gdpfdvkteqgpqidqkqfdkileliesgkkegaklecggsamedkglfikptvfsevtd
    nmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtv
    wincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklgdknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhzE (E:)
    pirnlevkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaqvaf
    qrgspwrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcirtlr
    yfagwadkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgntmv
    lkpaeqtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgstevg
    klvkeaasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasrvfv
    eeqvysefvrrsveyakkrpvgdpfdvkteqgpqidqkqfdkileliegaklecggsadk
    glfikptvfsevtdnmriakeeifgpvqpilkfksieevikranstdygltaavftknld
    kalklasalesgtvwincynalyaqapfggfkmsgngrelgeyalaeytevktvtikl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5fhzF (F:)
    hhhhhhlestslykkagmatangavengqpdrkppalprpirnlevkftkifinnewhes
    ksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspwrrldalsrgrllhql
    adlverdratlaaletmdtgkpflhaffidlegcirtlryfagwadkiqgktiptddnvv
    cftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeqtpltalylgslikea
    gfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkeaasrsnlkrvtlelgg
    knpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvysefvrrsveyakkrpv
    gdpfdvkteqgpqidqkqfdkileliesgkkegaklecggsamedkglfikptvfsevtd
    nmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtv
    wincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklgdknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhzF (F:)
    evkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgsp
    wrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcirtlryfagw
    adkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpae
    qtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvke
    aasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvy
    sefvrrsveygdpfgpqidqkqfdkilliesgkkegaklecggsaptvfsevtdnmpvqp
    ilkfksieevikranstdygltaavftknldkalklasalesgtvwincynalyaqapfg
    gfkmsgngrelgeyalaeytevktvtikl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5fhzG (G:)
    hhhhhhlestslykkagmatangavengqpdrkppalprpirnlevkftkifinnewhes
    ksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspwrrldalsrgrllhql
    adlverdratlaaletmdtgkpflhaffidlegcirtlryfagwadkiqgktiptddnvv
    cftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeqtpltalylgslikea
    gfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkeaasrsnlkrvtlelgg
    knpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvysefvrrsveyakkrpv
    gdpfdvkteqgpqidqkqfdkileliesgkkegaklecggsamedkglfikptvfsevtd
    nmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtv
    wincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklgdknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhzG (G:)
    vkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspw
    rrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcirtlryfagwa
    dkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeq
    tpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkea
    asrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvys
    efvrrsveyakkrpvgdpfdvkteqgpqidqkqfdkileliesgkkegaklecgfikptv
    fsevtdifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtvwi
    ncynalyaqapfggfkmsgngrelgeyalaeytevktvtikl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5fhzH (H:)
    hhhhhhlestslykkagmatangavengqpdrkppalprpirnlevkftkifinnewhes
    ksgkkfatcnpstreqiceveegdkpdvdkaveaaqvafqrgspwrrldalsrgrllhql
    adlverdratlaaletmdtgkpflhaffidlegcirtlryfagwadkiqgktiptddnvv
    cftrhepigvcgaitpwnfpllmlvwklapalccgntmvlkpaeqtpltalylgslikea
    gfppgvvnivpgfgptvgaaisshpqinkiaftgstevgklvkeaasrsnlkrvtlelgg
    knpcivcadadldlavecahqgvffnqgqcctaasrvfveeqvysefvrrsveyakkrpv
    gdpfdvkteqgpqidqkqfdkileliesgkkegaklecggsamedkglfikptvfsevtd
    nmriakeeifgpvqpilkfksieevikranstdygltaavftknldkalklasalesgtv
    wincynalyaqapfggfkmsgngrelgeyalaeytevktvtiklgdknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fhzH (H:)
    prpirnlevkftkifinnewhesksgkkfatcnpstreqiceveegdkpdvdkaveaaqv
    afqrgspwrrldalsrgrllhqladlverdratlaaletmdtgkpflhaffidlegcirt
    lryfagwadkiqgktiptddnvvcftrhepigvcgaitpwnfpllmlvwklapalccgnt
    mvlkpaeqtpltalylgslikeagfppgvvnivpgfgptvgaaisshpqinkiaftgste
    vgklvkeaasrsnlkrvtlelggknpcivcadadldlavecahqgvffnqgqcctaasrv
    fveeqvysefvrrsveyakkrpvgdpfdvkteqgpqidqkqfdkileliesgkkegakle
    cggsamedkglfikptvfsevtdnmriakeeifgpvqpilkfksieevikranstdyglt
    aavftknldkalklasalesgtvwincynalyaqapfggfkmsgngrelgeyalaeytev
    ktvtiklg