PDB entry 5fhb

View 5fhb on RCSB PDB site
Description: Crystal Structure of Protective Ebola Virus Antibody 100
Class: immune system
Keywords: Ig domain, Fab, immune system
Deposited on 2015-12-21, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody 100 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FHB (0-227)
  • Chain 'L':
    Compound: Antibody 100 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FHB (0-207)
    Domains in SCOPe 2.06: d5fhbl1, d5fhbl2
  • Heterogens: EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5fhbL (L:)
yeltqplsvsvspgqtaiftcsgdnlgdkyvcwfqqrpgqspmlliyqdnkrpsgiperf
sgsnsgntatltisgtqstdeadyycqtwdstvvfgggtkltvlgqpkaapsvtlfppss
eelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltp
eqwkshrsyscqvthegstvektvapte