PDB entry 5ffz

View 5ffz on RCSB PDB site
Description: S. aureus MepR bound to ethidium bromide
Class: transcription
Keywords: Winged helix-turn-helix, protein-ligand complex, transcription regulation, multidrug resistance, TRANSCRIPTION-DNA complex, TRANSCRIPTION
Deposited on 2015-12-19, released 2016-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (2-139)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5ffza1, d5ffza2
  • Heterogens: ET, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ffzA (A:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq