PDB entry 5ffx

View 5ffx on RCSB PDB site
Description: S. aureus MepR G34K Mutant
Class: transcription regulator
Keywords: Winged helix-turn-helix, DNA binding protein, transcription regulation, multidrug resistance, TRANSCRIPTION REGULATOR
Deposited on 2015-12-19, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (23-160)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5ffxa_
  • Chain 'B':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (23-160)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5ffxb_
  • Chain 'C':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (23-160)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5ffxc_
  • Chain 'D':
    Compound: MarR family regulatory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (Start-160)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d5ffxd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ffxA (A:)
    mhhhhhhssgvdlgtenlyfqsneftysylfrmishemkqkadqkleqfditneqkhtlg
    ylyahqqdgltqndiakalqrtgptvsnllrnlerkkliyryvdaqdtrrkniglttsgi
    klveaftsifdemeqtlvsqlseeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ffxA (A:)
    eftysylfrmishemkqkadqkleqfditneqkhtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
    eeneqmkanltkmlsslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ffxB (B:)
    mhhhhhhssgvdlgtenlyfqsneftysylfrmishemkqkadqkleqfditneqkhtlg
    ylyahqqdgltqndiakalqrtgptvsnllrnlerkkliyryvdaqdtrrkniglttsgi
    klveaftsifdemeqtlvsqlseeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ffxB (B:)
    eftysylfrmishemkqkadqkleqfditneqkhtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
    eeneqmkanltkmlsslq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ffxC (C:)
    mhhhhhhssgvdlgtenlyfqsneftysylfrmishemkqkadqkleqfditneqkhtlg
    ylyahqqdgltqndiakalqrtgptvsnllrnlerkkliyryvdaqdtrrkniglttsgi
    klveaftsifdemeqtlvsqlseeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ffxC (C:)
    eftysylfrmishemkqkadqkleqfditneqkhtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
    eeneqmkanltkmlsslq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ffxD (D:)
    mhhhhhhssgvdlgtenlyfqsneftysylfrmishemkqkadqkleqfditneqkhtlg
    ylyahqqdgltqndiakalqrtgptvsnllrnlerkkliyryvdaqdtrrkniglttsgi
    klveaftsifdemeqtlvsqlseeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ffxD (D:)
    ftysylfrmishemkqkadqkleqfditneqkhtlgylyahqqdgltqndiakalqrtgp
    tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee
    eneqmkanltkmlsslq