PDB entry 5fft

View 5fft on RCSB PDB site
Description: Crystal Structure of Surfactant Protein-A Y221A Mutant
Class: sugar binding protein
Keywords: collectin, carbohydrate binding, lectin, lipid binding, sugar binding protein
Deposited on 2015-12-18, released 2016-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sftpa1, Sftp-1, Sftp1, Sftpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08427 (Start-147)
      • engineered mutation (106)
      • engineered mutation (140)
    Domains in SCOPe 2.06: d5ffta1, d5ffta2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5fftA (A:)
ayldeelqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctragg
niavprtpeeneaiasiakkynnyvylgmiedqtpgdfhyldgasvsytnwypgeprgqg
kekcvemytdgtwndrgclqarlavcef

    Sequence, based on observed residues (ATOM records): (download) 
    >5fftA (A:)
elqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctraggniavp
rtpeeneaiasiakkynnyvylgmiedqtpgdfhyldgasvsytnwypgeprgqgkekcv
emytdgtwndrgclqarlavcef