PDB entry 5fea

View 5fea on RCSB PDB site
Description: Domain Swapped Bromodomain from Leishmania donovani
Class: unknown function
Keywords: BROMODOMAIN, DOMAIN-SWAPPING, BROMOSPORINE, Structural Genomics Consortium (SGC), UNKNOWN FUNCTION
Deposited on 2015-12-16, released 2016-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Leishmania donovani (strain BPK282A1) [TaxId:981087]
    Gene: LDBPK_363520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5feaa_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Leishmania donovani (strain BPK282A1) [TaxId:981087]
    Gene: LDBPK_363520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5feab_
  • Heterogens: BR, BMF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5feaA (A:)
    hprplpagkhahrqsletipevaelyhciyklyneeessvwfrepvnalaqeiftyydvv
    kspmslrhildnivkgdtystalqvmedveliwkncitfngansllateagkcrsaldri
    rrayqddqritveeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5feaA (A:)
    hprplpagkhahrqsletipevaelyhciyklyneeessvwfrepvnalaqeiftyydvv
    kspmslrhildnivkgdtystalqvmedveliwkncitfngansllateagkcrsaldri
    rrayq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5feaB (B:)
    hprplpagkhahrqsletipevaelyhciyklyneeessvwfrepvnalaqeiftyydvv
    kspmslrhildnivkgdtystalqvmedveliwkncitfngansllateagkcrsaldri
    rrayqddqritveeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5feaB (B:)
    khahrqsletipevaelyhciyklyneeessvwfrepvnalaqeiftyydvvkspmslrh
    ildnivkgdtystalqvmedveliwkncitfngansllateagkcrsaldrirrayqddq
    r