PDB entry 5fd6

View 5fd6 on RCSB PDB site
Description: zinc-bound manganese uptake regulator
Class: transcription
Keywords: manganese uptake regulator, fur, mur, ferric uptake regulator, transcription
Deposited on 2015-12-15, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315
      • engineered mutation (11)
    Domains in SCOPe 2.07: d5fd6a_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315
      • engineered mutation (11)
    Domains in SCOPe 2.07: d5fd6b_
  • Chain 'C':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315
      • engineered mutation (11)
    Domains in SCOPe 2.07: d5fd6c_
  • Chain 'D':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315
      • engineered mutation (11)
    Domains in SCOPe 2.07: d5fd6d_
  • Heterogens: ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fd6A (A:)
    mtdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyr
    tvklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriare
    hgfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd6A (A:)
    aktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvkl
    fedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfr
    lvdhrlelygvplkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fd6B (B:)
    mtdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyr
    tvklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriare
    hgfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd6B (B:)
    ktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvklf
    edagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfrl
    vdhrlelygvpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fd6C (C:)
    mtdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyr
    tvklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriare
    hgfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd6C (C:)
    ktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvklf
    edagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfrl
    vdhrlelygvpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fd6D (D:)
    mtdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyr
    tvklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriare
    hgfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd6D (D:)
    ktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvklf
    edagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfrl
    vdhrlelygvplk