PDB entry 5fd5

View 5fd5 on RCSB PDB site
Description: manganese uptake regulator
Class: transcription
Keywords: fur, ferric uptake regulator, apo, mur, transcription
Deposited on 2015-12-15, released 2016-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315 (0-End)
      • engineered mutation (10)
    Domains in SCOPe 2.06: d5fd5a_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315
      • engineered mutation (10)
    Domains in SCOPe 2.06: d5fd5b_
  • Chain 'C':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315
      • engineered mutation (10)
    Domains in SCOPe 2.06: d5fd5c_
  • Chain 'D':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315
      • engineered mutation (10)
    Domains in SCOPe 2.06: d5fd5d_
  • Chain 'E':
    Compound: ferric uptake regulation protein
    Species: Rhizobium leguminosarum bv. viciae [TaxId:387]
    Gene: fur
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07315
      • engineered mutation (10)
    Domains in SCOPe 2.06: d5fd5e_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fd5A (A:)
    tdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrt
    vklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriareh
    gfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd5A (A:)
    tdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrt
    vklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriareh
    gfrlvdhrlelygvplk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fd5B (B:)
    tdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrt
    vklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriareh
    gfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd5B (B:)
    dvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtv
    klfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehg
    frlvdhrlelygvplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fd5C (C:)
    tdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrt
    vklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriareh
    gfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd5C (C:)
    vaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvk
    lfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgf
    rlvdhrlelygvplk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fd5D (D:)
    tdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrt
    vklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriareh
    gfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd5D (D:)
    aktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvkl
    fedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfr
    lvdhrlelygvpl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5fd5E (E:)
    tdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrt
    vklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriareh
    gfrlvdhrlelygvplkkedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fd5E (E:)
    tleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvklfe
    dagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfrlv
    dhrlelygvplk