PDB entry 5fc8

View 5fc8 on RCSB PDB site
Description: Mouse importin alpha: Dengue 3 NS5 C-terminal NLS peptide complex
Class: PROTEIN TRANSPORT/Viral Protein
Keywords: Dengue, NS5, Importin, PROTEIN TRANSPORT-Viral Protein complex
Deposited on 2015-12-15, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Nonstructural protein 5
    Species: Dengue virus 3 [TaxId:11069]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fc8e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5fc8E (E:)
    mhhhhhhssglvprgsgmletaaalfernhmdspdlgtddddlamadigsnqgtvnwsve
    divkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcspiqfe
    sawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgsafrdl
    vikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilptlvrl
    lhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpalraign
    ivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvvnhglv
    pflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdtkiiqv
    ildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliekyfsve
    eeedqnvvpettsegfafqvqdgapgtfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fc8E (E:)
    qgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgk
    tdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgnia
    gdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldave
    qilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpiv
    tpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqi
    qqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnlls
    akdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasln
    liekyfs