PDB entry 5fbz

View 5fbz on RCSB PDB site
Description: Structure of subtilase SubHal from Bacillus halmapalus - complex with chymotrypsin inhibitor CI2A
Class: hydrolase
Keywords: Protease, Subtilase, Calcium binding, CI2A inhibitor, hydrolase
Deposited on 2015-12-14, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enzyme subtilase SubHal from Bacillus halmapalus
    Species: Bacillus halmapalus [TaxId:79882]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FBZ (0-432)
    Domains in SCOPe 2.07: d5fbza1, d5fbza2
  • Chain 'B':
    Compound: subtilisin-chymotrypsin inhibitor-2a
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01053 (Start-71)
      • conflict (66)
    Domains in SCOPe 2.07: d5fbzb_
  • Chain 'C':
    Compound: Enzyme subtilase SubHal from Bacillus halmapalus
    Species: Bacillus halmapalus [TaxId:79882]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FBZ (0-432)
    Domains in SCOPe 2.07: d5fbzc1, d5fbzc2
  • Chain 'D':
    Compound: subtilisin-chymotrypsin inhibitor-2a
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01053 (Start-71)
      • conflict (66)
    Domains in SCOPe 2.07: d5fbzd1
  • Chain 'E':
    Compound: Autoproteolytic fragment of enzyme subtilase SubHal
    Species: Bacillus halmapalus [TaxId:79882]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FBZ (0-4)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fbzA (A:)
    xdvargivkadvaqnnfglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
    nandpnghgthvagsvlgnatnkgmapqanlvfqsimdsggglgglpanlqtlfsqaysa
    garihtnswgapvngayttdsrnvddyvrkndmtilfaagnegpgsgtisapgtaknait
    vgatenlrpsfgsyadninhvaqfssrgptrdgrikpdvmapgtyilsarsslapdssfw
    anhdskyaymggtsmatpivagnvaqlrehfvknrgvtpkpsllkaaliagaadvglgfp
    ngnqgwgrvtldkslnvafvnetsplstsqkatysftaqagkplkislvwsdapgsttas
    ltlvndldlvitapngtkyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynv
    pvgpqtfslaivh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fbzB (B:)
    tgagdrhnlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvd
    kldniaevprvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fbzB (B:)
    rhnlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldni
    aevprvg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fbzC (C:)
    xdvargivkadvaqnnfglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
    nandpnghgthvagsvlgnatnkgmapqanlvfqsimdsggglgglpanlqtlfsqaysa
    garihtnswgapvngayttdsrnvddyvrkndmtilfaagnegpgsgtisapgtaknait
    vgatenlrpsfgsyadninhvaqfssrgptrdgrikpdvmapgtyilsarsslapdssfw
    anhdskyaymggtsmatpivagnvaqlrehfvknrgvtpkpsllkaaliagaadvglgfp
    ngnqgwgrvtldkslnvafvnetsplstsqkatysftaqagkplkislvwsdapgsttas
    ltlvndldlvitapngtkyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynv
    pvgpqtfslaivh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fbzD (D:)
    tgagdrhnlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvd
    kldniaevprvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fbzD (D:)
    rktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaev
    prvg
    

  • Chain 'E':
    No sequence available.