PDB entry 5fax

View 5fax on RCSB PDB site
Description: Structure of subtilase SubHal from Bacillus halmapalus
Class: hydrolase
Keywords: Protease, Subtilase, Calcium binding, hydrolase
Deposited on 2015-12-12, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Subtilase SubHal from Bacillus halmapalus
    Species: Bacillus halmapalus [TaxId:79882]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FAX (0-432)
    Domains in SCOPe 2.07: d5faxa1, d5faxa2
  • Chain 'B':
    Compound: Subtilase SubHal from Bacillus halmapalus
    Species: Bacillus halmapalus [TaxId:79882]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FAX (0-432)
    Domains in SCOPe 2.07: d5faxb1, d5faxb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5faxA (A:)
    xdvargivkadvaqnnfglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
    nandpnghgthvagsvlgnatnkgmapqanlvfqsimdsggglgglpanlqtlfsqaysa
    garihtnswgapvngayttdsrnvddyvrkndmtilfaagnegpgsgtisapgtaknait
    vgatenlrpsfgsyadninhvaqfssrgptrdgrikpdvmapgtyilsarsslapdssfw
    anhdskyaymggtsmatpivagnvaqlrehfvknrgvtpkpsllkaaliagaadvglgfp
    ngnqgwgrvtldkslnvafvnetsplstsqkatysftaqagkplkislvwsdapgsttas
    ltlvndldlvitapngtkyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynv
    pvgpqtfslaivh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5faxB (B:)
    xdvargivkadvaqnnfglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
    nandpnghgthvagsvlgnatnkgmapqanlvfqsimdsggglgglpanlqtlfsqaysa
    garihtnswgapvngayttdsrnvddyvrkndmtilfaagnegpgsgtisapgtaknait
    vgatenlrpsfgsyadninhvaqfssrgptrdgrikpdvmapgtyilsarsslapdssfw
    anhdskyaymggtsmatpivagnvaqlrehfvknrgvtpkpsllkaaliagaadvglgfp
    ngnqgwgrvtldkslnvafvnetsplstsqkatysftaqagkplkislvwsdapgsttas
    ltlvndldlvitapngtkyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynv
    pvgpqtfslaivh