PDB entry 5f9k

View 5f9k on RCSB PDB site
Description: Dictyostelium discoideum dUTPase at 2.2 Angstrom
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-12-09, released 2016-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: dut, DDB_G0293374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54BW5 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d5f9ka1, d5f9ka2
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: dut, DDB_G0293374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54BW5 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d5f9kb1, d5f9kb2
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: dut, DDB_G0293374
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54BW5 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d5f9kc1, d5f9kc2
  • Heterogens: DUP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f9kA (A:)
    gshmfkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygr
    iaprsglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpe
    plevdeidetqrgaggfgstgvkvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f9kA (A:)
    gshmfkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygr
    iaprsglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpe
    plevdeid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f9kB (B:)
    gshmfkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygr
    iaprsglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpe
    plevdeidetqrgaggfgstgvkvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f9kB (B:)
    gshmfkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygr
    iaprsglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpe
    plevdeidet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5f9kC (C:)
    gshmfkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygr
    iaprsglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpe
    plevdeidetqrgaggfgstgvkvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f9kC (C:)
    gshmfkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygr
    iaprsglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpe
    plevdeid